4.78 Rating by CuteStat

tradersofthelostartinc.com is 7 years 8 months old. It is a domain having com extension. It has a global traffic rank of #6524236 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. As no active threats were reported recently by users, tradersofthelostartinc.com is SAFE to browse.

PageSpeed Score
91
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 129
Daily Pageviews: 258

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 6,524,236
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

72.167.191.69

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822
Traders of the Lost Art, Inc. Inspirational gifts store

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 3
H3 Headings: 1 H4 Headings: 4
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 3
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 72.167.191.69)

InTrade

- intrade.com
5,325,373 $ 240.00

Rayleigh Airport Transfer

- rayleightaxis.co.uk

Airport Transfer Rayleigh | Rayleigh Chauffeur Service | Airport transfers Rayleigh | Luxury Airport Taxi Rayleigh | Rayleigh Airport Taxi | Rayleigh taxi to Heathrow Airport | taxi from Rayleigh to Gatwick airport | taxi from Rayleigh to Stansted Airport | Rayleigh taxi to Ebbsfleet Station | Rayleigh to London taxi |

Not Applicable $ 8.95

السعودية الآن

- saudinow.com

السعودية

9,418,803 $ 240.00

Home | GSC Specialty Contractors

- gsc-demo.com
Not Applicable $ 8.95

Author DM

- authordm.com

Search Books By Author - Make Money Online AuthorDM

Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Link: <https://img1.wsimg.com/poly/v2/polyfill.min.js?unknown=polyfill&flags=gated&features=default%2Cfetch%2CArray.prototype.%40%40iterator%2CArray.prototype.find%2CArray.prototype.findIndex%2CFunction.name%2CNumber.isFinite%2CPromise%2CString.prototype.repeat%2CMath.sign%2CMath.trunc%2CArray.prototype.includes%2CObject.entries%2CObject.values%2CIntersectionObserver%2CIntl.~locale.en-US>; rel=preload; as=script; crossorigin,<//img1.wsimg.com/blobby/go/gpub/e645c3e6fe995b50/script.js>; rel=preload; as=script; crossorigin,<//img1.wsimg.com/ceph-p3-01/website-builder-data-prod/static/widgets/UX.3.55.37.js>; rel=preload; as=script; crossorigin,<https://img1.wsimg.com/gfonts/s/lato/v16/S6uyw4BMUTPHjx4wXiWtFCc.woff2>; rel=preload; as=font; crossorigin,<https://img1.wsimg.com/gfonts/s/lato/v16/S6u9w4BMUTPHh6UVSwiPGQ3q5d0.woff2>; rel=preload; as=font; crossorigin,<https://img1.wsimg.com/gfonts/s/lusitana/v7/CSR84z9ShvucWzsMKyhdTOIAStt-.woff2>; rel=preload; as=font; crossorigin,<https://img1.wsimg.com/gfonts/s/lusitana/v7/CSR74z9ShvucWzsMKyDmafctaNZUvuwl.woff2>; rel=preload; as=font; crossorigin,<https://fonts.googleapis.com>; rel=preconnect; crossorigin,<https://fonts.gstatic.com>; rel=preconnect; crossorigin,<https://img1.wsimg.com>; rel=preconnect; crossorigin
Cache-Control: max-age=30
Content-Security-Policy: frame-ancestors 'self'
Content-Type: text/html;charset=utf-8
Vary: Accept-Encoding
Content-Encoding: gzip
Server: DPS/1.6.14
X-SiteId: 1000
ETag: 3f2c3e12878426f3127124b1c8672876
Date: Mon, 30 Dec 2019 05:07:01 GMT
Connection: keep-alive
Transfer-Encoding: chunked

Domain Information

Domain Registrar: acens Technologies, S.L.U.
Registration Date: Aug 28, 2016, 5:46 AM 7 years 8 months 2 weeks ago
Expiration Date: Aug 28, 2020, 5:46 AM 3 years 8 months 2 weeks ago
Domain Status:
clienttransferprohibited
clientupdateprohibited
clientrenewprohibited
clientdeleteprohibited

Domain Nameserver Information

Host IP Address Country
ns77.domaincontrol.com 97.74.108.49 United States of America United States of America
ns78.domaincontrol.com 173.201.76.49 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
tradersofthelostartinc.com A 600 IP: 72.167.191.69
tradersofthelostartinc.com NS 3600 Target: ns78.domaincontrol.com
tradersofthelostartinc.com NS 3600 Target: ns77.domaincontrol.com
tradersofthelostartinc.com SOA 600 MNAME: ns77.domaincontrol.com
RNAME: dns.jomax.net
Serial: 2019122400
Refresh: 28800
Retry: 7200
Expire: 604800
Minimum TTL: 600
tradersofthelostartinc.com MX 3600 Priority: 10
Target: mailstore1.secureserver.net
tradersofthelostartinc.com MX 3600 Target: smtp.secureserver.net

Similarly Ranked Websites

Jess Ainscough - The Wellness Warrior

- jessainscough.com

The Wellness Warrior | Be kind. Be brave. Be well.

6,524,237 $ 240.00

trustme.business — Coming Soon

- trustme.business

This is a default index page for a new domain.

6,524,240 $ 240.00

Fat Diminisher System eBook Review By Wesley Virgin

- fatdiminishersystemreviewpdf.com

Today i am going to show you Fat Diminisher System eBook Review By Wesly Virgin in a detail. What actually the program is all about and does it really work?

6,524,247 $ 8.95

Welcome - Mathematical Association of NSW Inc.

- mansw.nsw.edu.au
6,524,256 $ 240.00

Welcome To Ismail Nasir Shipping L.L.C

- ismailnasirshipping.com
6,524,262 $ 240.00

Full WHOIS Lookup

Domain Name: tradersofthelostartinc.com
Registry Domain ID: 2055617455_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2018-08-28T14:29:38Z
Creation Date: 2016-08-28T00:01:22Z
Registrar Registration Expiration Date: 2020-08-28T00:01:22Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Registration Private
Registrant Organization: Domains By Proxy, LLC
Registrant Street: DomainsByProxy.com
Registrant Street: 14455 N. Hayden Road
Registrant City: Scottsdale
Registrant State/Province: Arizona
Registrant Postal Code: 85260
Registrant Country: US
Registrant Phone: +1.4806242599
Registrant Phone Ext:
Registrant Fax: +1.4806242598
Registrant Fax Ext:
Registrant Email: tradersofthelostartinc.com@domainsbyproxy.com
Registry Admin ID: Not Available From Registry
Admin Name: Registration Private
Admin Organization: Domains By Proxy, LLC
Admin Street: DomainsByProxy.com
Admin Street: 14455 N. Hayden Road
Admin City: Scottsdale
Admin State/Province: Arizona
Admin Postal Code: 85260
Admin Country: US
Admin Phone: +1.4806242599
Admin Phone Ext:
Admin Fax: +1.4806242598
Admin Fax Ext:
Admin Email: tradersofthelostartinc.com@domainsbyproxy.com
Registry Tech ID: Not Available From Registry
Tech Name: Registration Private
Tech Organization: Domains By Proxy, LLC
Tech Street: DomainsByProxy.com
Tech Street: 14455 N. Hayden Road
Tech City: Scottsdale
Tech State/Province: Arizona
Tech Postal Code: 85260
Tech Country: US
Tech Phone: +1.4806242599
Tech Phone Ext:
Tech Fax: +1.4806242598
Tech Fax Ext:
Tech Email: tradersofthelostartinc.com@domainsbyproxy.com
Name Server: NS77.DOMAINCONTROL.COM
Name Server: NS78.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2019-12-30T05:00:00Z <<<

For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en

Notes:

IMPORTANT: Port43 will provide the ICANN-required minimum data set per
ICANN Temporary Specification, adopted 17 May 2018.
Visit https://whois.godaddy.com to look up contact data for domains
not covered by GDPR policy.

The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC. By submitting an inquiry,
you agree to these terms of usage and limitations of warranty. In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam. You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.

Please note: the registrant of the domain name is specified
in the "registrant" section. In most cases, GoDaddy.com, LLC
is not the registrant of domain names listed in this database.